NKAIN4 antibody (N-Term)

Catalog No. ABIN636103

Product Details anti-NKAIN4 Antibody

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKAIN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NKAIN4 antibody was raised against the N terminal of NKAIN4

Purification: Affinity purified

Immunogen: NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKAIN4 Blocking Peptide, catalog no. 33R-6073, is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKAIN4

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Alternative Name: NKAIN4 (NKAIN4 Products)

Synonyms: zgc:172210 antibody, C20orf58 antibody, FAM77A antibody, bA261N11.2 antibody, AB030182 antibody, C030019F02Rik antibody, RGD1305809 antibody, sodium/potassium transporting ATPase interacting 4 antibody, Na+/K+ transporting ATPase interacting 4 antibody, Sodium/potassium transporting ATPase interacting 4 antibody, sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 antibody, nkain4 antibody, NKAIN4 antibody, Nkain4 antibody

Background: The specific function of NKAIN4 is not yet known.

Molecular Weight: 23 kDa (MW of target protein)