EDAR antibody (Middle Region)

Catalog No. ABIN636121

This Rabbit Polyclonal antibody specifically detects EDAR in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EDAR antibody (Middle Region) (ABIN636121)

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EDAR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EDAR Antibody

Binding Specificity: Middle Region

Specificity: Ectodysplasin A Receptor antibody was raised against the middle region of EDAR

Purification: Affinity purified

Immunogen: Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ectodysplasin A Receptor Blocking Peptide, (ABIN5613300), is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A Receptor antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EDAR

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Alternative Name: Ectodysplasin A Receptor

Background: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Tube Formation, Ubiquitin Proteasome Pathway