NONO antibody

Catalog No. ABIN6654182

This anti-NONO antibody is a Mouse Monoclonal antibody detecting NONO in WB, ICC and FACS. Suitable for Human.

Quick Overview for NONO antibody (ABIN6654182)

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This NONO antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC), Flow Cytometry (FACS)

Clone: 11E2-

Product Details anti-NONO Antibody

Purification: Protein G affinity

Immunogen: Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the NONO antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,ICC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NONO antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NONO

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Alternative Name: NONO / p54nrb

Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

UniProt: Q15233