HECTD3 antibody

Catalog No. ABIN6719595

Product Details anti-HECTD3 Antibody

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HECTD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Flow Cytometry (FACS)

Purpose: Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Sequence: HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human HECTD3(HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HECTD3

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Alternative Name: HECTD3 (HECTD3 Products)

Synonyms: 1700064K09Rik antibody, AI467540 antibody, AW743312 antibody, RP11-69J16.1 antibody, E3 ubiquitin-protein ligase HECTD3-like antibody, HECT domain E3 ubiquitin protein ligase 3 antibody, LOC100222219 antibody, HECTD3 antibody, Hectd3 antibody

Background:

Synonyms: E3 ubiquitin-protein ligase HECTD3, HECT domain-containing protein 3, HECT-type E3 ubiquitin transferase HECTD3, HECTD3

Background: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.

Gene ID: 79654

UniProt: Q5T447