CHRM1 antibody (AA 227-353)

Catalog No. ABIN7043060

Product Details anti-CHRM1 Antibody

Target: CHRM1 (Muscarinic Acetylcholine Receptor M1 (CHRM1))

Binding Specificity: AA 227-353

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRM1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunochromatography (IC)

Purpose: A Rabbit Polyclonal Antibody to Muscarinic Acetylcholine Receptor M1

Specificity: 3rd intracellular loop

Cross-Reactivity: Human, Mouse, Rat

Predicted Reactivity: mouse - 124, rat - 123,Macaca mulatta - 125,127 amino acid residues identical, gerbil - 123, pig - 124

Characteristics: Anti-CHRM1 Antibody is directed against the 3rd intracellular loop of the human M1 muscarinic receptor. Anti-CHRM1 Antibody (ABIN7043060, ABIN7044580 and ABIN7044581)) can be used in western blot analysis, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize M1 from human, mouse and rat samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Grade: KO Validated

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human M1

Isotype: IgG

Application Details

Application Notes:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:200

Comment:

Cited Application: IHC

Negative Control: BLP-MR001

Blocking Peptide: BLP-MR001

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW).

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Storage: 4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for CHRM1

Target: CHRM1 (Muscarinic Acetylcholine Receptor M1 (CHRM1))

Alternative Name: CHRM1 (CHRM1 Products)

Background: Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1,The action of the neurotransmitter acetylcholine (ACh) is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named M1-M5.1-2The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The M1 receptors are the most abundant muscarinic subtype in the cortex and striatum. M1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of ACh from the nerves.5-6The M1, M3 and M5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the M1, M3 and M5 receptors is an essential element for the anti-apoptotic response of those receptors.7

Alternative names: M1 Muscarinic Receptor, CHRM1, Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1

Gene ID: 1128

NCBI Accession: NM_000738

UniProt: P11229

Pathways: Synaptic Membrane