Muscarinic Acetylcholine Receptor M2 antibody (AA 225-356)

Catalog No. ABIN7043062

Product Details anti-Muscarinic Acetylcholine Receptor M2 Antibody

Target: Muscarinic Acetylcholine Receptor M2 (CHRM2) (Cholinergic Receptor, Muscarinic 2 (CHRM2))

Binding Specificity: AA 225-356

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Muscarinic Acetylcholine Receptor M2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunochromatography (IC)

Purpose: A Rabbit Polyclonal Antibody to Muscarinic Acetylcholine Receptor M2

Specificity: 3rd intracellular loop

Cross-Reactivity: Human, Mouse, Rat

Predicted Reactivity: 132 amino acid residues identical, dog - 122, orangutan - 130, pig - 122,gorilla - identical,Chimpanzee, rat - 118, mouse - 117

Characteristics: Anti-CHRM2 Antibody (ABIN7043062, ABIN7044582 and ABIN7044583) is a highly specific antibody directed against an epitope of the human M2 muscarinic receptor. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize M2 from mouse, rat, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Grade: KO Validated

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid residues 225-356 of human M2

Isotype: IgG

Application Details

Application Notes:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: 1:100

Application Dilutions Western blot wb: 1:200

Comment:

Cited Application: IP|IHC|ICC

Negative Control: (ABIN7235118)

Blocking Peptide: (ABIN7235118)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW).

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Storage: 4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for Muscarinic Acetylcholine Receptor M2

Target: Muscarinic Acetylcholine Receptor M2 (CHRM2) (Cholinergic Receptor, Muscarinic 2 (CHRM2))

Alternative Name: CHRM2 (CHRM2 Products)

Background: Muscarinic acetylcholine receptor M2, Cholinergic receptor muscarinic 2, mAChR M2,The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-transmembrane G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned and are named M1-M5.1-2The muscarinic receptors are widely distributed throughout the body but are predominantly expressed in the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing, and motor control.1 They also participate in learning and memory processing.3-4The M2 receptor is considered to be the predominant muscarinic receptor subtype that is expressed in cardiac muscle.5The M2 and M4 receptors mediate Ca2+ channel inhibition and Kir3 K+ channel activation by directly binding the Gβγ subunit to the channel.6,7 Stimulation of the M2 receptor by acetylcholine in the heart results in activation of the Kir3.1/Kir3.4 channels causing a slowing in heart beat.7

Alternative names: M2 Muscarinic Receptor, CHRM2, Muscarinic acetylcholine receptor M2, Cholinergic receptor muscarinic 2, mAChR M2

Gene ID: 1129

NCBI Accession: NM_000739

UniProt: P08172