STX1A antibody (Intracellular, N-Term)

Catalog No. ABIN7237876

This Rabbit Polyclonal antibody specifically detects STX1A in WB, IHC and IF. It exhibits reactivity toward Rat.

Quick Overview for STX1A antibody (Intracellular, N-Term) (ABIN7237876)

Target: STX1A (Syntaxin 1A (Brain) (STX1A))

Reactivity: Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STX1A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)

Product Details anti-STX1A Antibody

Binding Specificity: AA 1-265, Intracellular, N-Term

Purpose: A Rabbit Polyclonal Antibody to Syntaxin 1

Cross-Reactivity: Mouse, Rat

Predicted Reactivity: Human,mouse- 264,265 amino acid residues identical

Characteristics: Intracellular, N-terminus

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A

Isotype: IgG

Application Details

Application Notes:

WB: 1:1000

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Comment:

Cited Application: IP

Negative Control: (ABIN7237335)

Blocking Peptide: (ABIN7237335)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: PBS pH 7.4, 1 % BSA with 0.05 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Target Details for STX1A

Target: STX1A (Syntaxin 1A (Brain) (STX1A))

Alternative Name: STX1A

Background:

Synonyms: STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Description: Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60-70 amino acids that are arranged in heptad repeats1,2.SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1,2.SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1,2.Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1,2.Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

Gene ID: 116470

NCBI Accession: NM_004603

UniProt: P32851

Pathways: Peptide Hormone Metabolism, Synaptic Membrane, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport