ACO2 antibody (AA 561-596)

Catalog No. ABIN7875784

The Mouse Monoclonal anti-ACO2 antibody (Clone 4C12D1) (ABIN7875784) specifically detects ACO2 in WB and IHC (p). The antibody is reactive with Human, Rat and Mouse samples.

Quick Overview for ACO2 antibody (AA 561-596) (ABIN7875784)

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This ACO2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 4C12D1

Product Details anti-ACO2 Antibody

Binding Specificity: AA 561-596

Purpose: ACO2 Antibody / Aconitase 2

Sequence: TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH

Purification: Antigen affinity purified

Immunogen: Amino acids 561-596 (TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH) were used as the immunogen for the ACO2 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the ACO2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ACO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Alternative Name: ACO2

Background: Aconitase 2, mitochondrial (also called Aconitate hydratase, mitochondrial) is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

UniProt: Q99798