GDF9 antibody (C-Term)

Catalog No. ABIN7877390

This Mouse Monoclonal antibody specifically detects GDF9 in WB, ELISA and IHC (p). It exhibits reactivity toward Human.

Quick Overview for GDF9 antibody (C-Term) (ABIN7877390)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This GDF9 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Grade: Carrier-free

Clone: GDF9-4261

Product Details anti-GDF9 Antibody

Binding Specificity: C-Term

Purpose: GDF9 Antibody (azide and preservative free)

Sequence: VPAKYSPLSV LTIEPDGSIA YKEYEDMIAT KC

Purification: Protein G affinity chromatography

Immunogen: Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the GDF9 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: 1 mg/mL in 1X PBS, BSA free, sodium azide free

Preservative: Azide free

Storage: 4 °C,-20 °C

Storage Comment: Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).

Target Details for GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Alternative Name: GDF9

Background: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

UniProt: O60383