POR antibody (C-Term)

Catalog No. ABIN7877442

The Mouse Monoclonal anti-POR antibody is suitable to detect POR in samples from Human. It has been validated for WB, FACS and IHC (p).

Quick Overview for POR antibody (C-Term) (ABIN7877442)

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This POR antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 7F5

Product Details anti-POR Antibody

Binding Specificity: C-Term

Purpose: Cytochrome P450 Reductase Antibody / POR / CYPOR

Sequence: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Purification: Antigen affinity purified

Immunogen: C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for POR

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Alternative Name: Cytochrome P450 Reductase

Background: POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interactome