DHODH antibody (N-Term)

Catalog No. ABIN7879597

The Mouse Monoclonal anti-DHODH antibody (Clone 2G7) (ABIN7879597) specifically detects DHODH in WB and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for DHODH antibody (N-Term) (ABIN7879597)

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This DHODH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2G7

Product Details anti-DHODH Antibody

Binding Specificity: N-Term

Purpose: Dihydroorotate dehydrogenase Antibody / DHODH

Sequence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E

Purification: Affinity purified

Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Dihydroorotate dehydrogenase antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Alternative Name: Dihydroorotate dehydrogenase

Background: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus