DHODH antibody (N-Term)

Catalog No. ABIN7879598

This Mouse Monoclonal antibody specifically detects DHODH in WB, IF and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DHODH antibody (N-Term) (ABIN7879598)

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This DHODH antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 4E3-

Product Details anti-DHODH Antibody

Binding Specificity: N-Term

Purpose: DHODH Antibody / Dihydroorotate dehydrogenase

Sequence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT ED

Purification: Antigen affinity purified

Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein were used as the immunogen for the DHODH antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the DHODH antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Alternative Name: DHODH

Background: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus