AFF4 antibody

Catalog No. ABIN7879910

This Mouse Monoclonal antibody specifically detects AFF4 in WB and FACS. It exhibits reactivity toward Human.

Quick Overview for AFF4 antibody (ABIN7879910)

Target: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This AFF4 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Clone: 8G12

Product Details anti-AFF4 Antibody

Purpose: AFF4 Antibody

Sequence: RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ

Purification: Affinity purified

Immunogen: Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the AFF4 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for AFF4

Target: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Alternative Name: AFF4

Background: The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

UniProt: Q9UHB7