AKR1D1 antibody

Catalog No. ABIN7879947

The Rabbit Polyclonal anti-AKR1D1 antibody is suitable to detect AKR1D1 in samples from Human, Rat and Mouse. It has been validated for WB and FACS.

Quick Overview for AKR1D1 antibody (ABIN7879947)

Target: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR1D1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Product Details anti-AKR1D1 Antibody

Purpose: AKR1D1 Antibody / Aldo-keto reductase family 1 member D1

Sequence: EEMKDIEALN KNVRFVELLM WRDHPEYPFH DEY

Purification: Antigen affinity purified

Immunogen: Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the AKR1D1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for AKR1D1

Target: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Alternative Name: AKR1D1

Background: Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

UniProt: P51857

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process