CCR10 antibody

Catalog No. ABIN7880397

The Rabbit Polyclonal anti-CCR10 antibody is suitable to detect CCR10 in samples from Human. It has been validated for WB and IHC (p).

Quick Overview for CCR10 antibody (ABIN7880397)

Target: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCR10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CCR10 Antibody

Purpose: CCR10 Antibody

Sequence: TEATEQVSWG HYSGDEEDAY SAEPLPELCY KADVQAFSRA FQ

Purification: Antigen affinity purified

Immunogen: Amino acids TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ from the human protein were used as the immunogen for the CCR10 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CCR10 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the CCR10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for CCR10

Target: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Alternative Name: CCR10

Background: C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues, the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27, MIM 604833), CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation.

UniProt: P46092