Cofilin 2 antibody

Catalog No. ABIN7880465

This Mouse Monoclonal antibody specifically detects Cofilin 2 in WB, IF, IHC (p), ICC and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Cofilin 2 antibody (ABIN7880465)

Target: Cofilin 2 (CFL2)

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This Cofilin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Flow Cytometry (FACS)

Clone: 8C13

Product Details anti-Cofilin 2 Antibody

Purpose: Cofilin 2 Antibody / CFL2

Sequence: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Purification: Affinity purified

Immunogen: Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Cofilin 2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Cofilin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Cofilin 2

Target: Cofilin 2 (CFL2)

Alternative Name: Cofilin 2

Background: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y281

Pathways: Caspase Cascade in Apoptosis