DHX15 antibody

Catalog No. ABIN7880608

The Rabbit Polyclonal anti-DHX15 antibody (ABIN7880608) specifically detects DHX15 in WB, IHC (p), IF and FACS. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for DHX15 antibody (ABIN7880608)

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX15 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Product Details anti-DHX15 Antibody

Purpose: DHX15 Antibody / Prp43

Sequence: DIKPEWLVKI APQYYDMSNF PQCEAKRQLD RIIAKLQSKE YSQY

Purification: Affinity purified

Immunogen: Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the DHX15 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the DHX15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for DHX15

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Alternative Name: DHX15

Background: Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

UniProt: O43143