TMEM166 antibody

Catalog No. ABIN7880761

The Rabbit Polyclonal anti-TMEM166 antibody (ABIN7880761) specifically detects TMEM166 in WB, IHC (p) and FACS. The antibody is reactive with Human samples.

Quick Overview for TMEM166 antibody (ABIN7880761)

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM166 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-TMEM166 Antibody

Purpose: TMEM166 Antibody / EVA1A

Sequence: MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA

Purification: Antigen affinity purified

Immunogen: Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TMEM166 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for TMEM166

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Alternative Name: TMEM166

Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

UniProt: Q9H8M9