FH antibody

Catalog No. ABIN7880830

The Mouse Monoclonal anti-FH antibody (Clone 9D8) (ABIN7880830) specifically detects FH in WB and IHC (p). The antibody is reactive with Human, Mouse, Rat and Monkey samples.

Quick Overview for FH antibody (ABIN7880830)

Target: FH (Fumarate Hydratase (FH))

Reactivity: Human, Mouse, Rat, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This FH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 9D8

Product Details anti-FH Antibody

Purpose: FH Antibody / Fumarate hydratase

Sequence: YDKAAKIAKT AHKNGSTLKE TAIELGYLTA EQFDEWVKPK DMLGPK

Purification: Protein G affinity

Immunogen: Amino acids YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK were used as the immunogen for the FH antibody.

Isotype: IgG2a

Application Details

Application Notes: Optimal dilution of the FH antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the FH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for FH

Target: FH (Fumarate Hydratase (FH))

Alternative Name: FH

Background: Fumarase (or fumarate hydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.

UniProt: P07954