HMGB3 antibody

Catalog No. ABIN7881048

The Mouse Monoclonal anti-HMGB3 antibody is suitable to detect HMGB3 in samples from Human, Mouse and Rat. It has been validated for WB, IF and FACS.

Quick Overview for HMGB3 antibody (ABIN7881048)

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This HMGB3 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 8H9

Product Details anti-HMGB3 Antibody

Purpose: HMG4 Antibody / HMGB3

Sequence: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Purification: Affinity purified

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMG4 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the HMG4 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HMG4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Alternative Name: HMG4

Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347