LPO antibody

Catalog No. ABIN7881485

The Rabbit Polyclonal anti-LPO antibody (ABIN7881485) specifically detects LPO in WB and IF. The antibody is reactive with Human samples.

Quick Overview for LPO antibody (ABIN7881485)

Target: LPO

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF)

Product Details

Purpose: LPO Antibody / Lactoperoxidase

Sequence: MFRLDENYQP WGPEPELPLH TLFFNTWRMV KD

Purification: Antigen affinity purified

Immunogen: Amino acids MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD from the human protein were used as the immunogen for the LPO antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LPO antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the LPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details

Target: LPO

Background: Lactoperoxidase is a peroxidase enzyme secreted from mammary, salivary and other mucosal glands including the lungs, bronchii and nose that functions as a natural and the first line of defense against antibacterial and antiviral agents. Lactoperoxidase is a member of the heme peroxidase family of enzymes. In humans, lactoperoxidase is encoded by the LPO gene. This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.

UniProt: P22079