MBD1 antibody

Catalog No. ABIN7881627

This Rabbit Polyclonal antibody specifically detects MBD1 in WB and FACS. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for MBD1 antibody (ABIN7881627)

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBD1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Product Details anti-MBD1 Antibody

Purpose: MBD1 Antibody

Sequence: DLTLFDFKQG ILCYPAPKAH PVAVASKKRK

Purification: Affinity purified

Immunogen: Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MBD1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the MBD1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MBD1

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Alternative Name: MBD1

Background: MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al.(1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al.(2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al.(2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.

UniProt: Q9UIS9