METTL3 antibody

Catalog No. ABIN7881630

This Rabbit Polyclonal antibody specifically detects METTL3 in WB, IF, ELISA, FACS and IHC (p). It exhibits reactivity toward Human.

Quick Overview for METTL3 antibody (ABIN7881630)

Target: METTL3 (Methyltransferase Like 3 (METTL3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL3 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-METTL3 Antibody

Purpose: METTL3 Antibody

Sequence: HNVQPNWITL GNQLDGIHLL DPDVVARFKQ RYPDGIISKP KNL

Purification: Affinity purified

Immunogen: Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the METTL3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the METTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for METTL3

Target: METTL3 (Methyltransferase Like 3 (METTL3))

Alternative Name: METTL3

Background: N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

UniProt: Q86U44