MSI1 antibody

Catalog No. ABIN7881686

The Rabbit Polyclonal anti-MSI1 antibody (ABIN7881686) specifically detects MSI1 in WB, ELISA and FACS. The antibody is reactive with Human samples.

Quick Overview for MSI1 antibody (ABIN7881686)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS)

Product Details anti-MSI1 Antibody

Purpose: Musashi 1 Antibody / MSI1

Sequence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Purification: Affinity purified

Immunogen: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Musashi 1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Musashi 1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Musashi 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Alternative Name: Musashi 1

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance