MSI1 antibody

Catalog No. ABIN7881687

This Mouse Monoclonal antibody specifically detects MSI1 in WB, IF and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MSI1 antibody (ABIN7881687)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This MSI1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2B9

Product Details anti-MSI1 Antibody

Purpose: Msi1 Antibody / Musashi 1

Sequence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Purification: Affinity purified

Immunogen: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Msi1 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Msi1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Msi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Alternative Name: Msi1

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance