MYH6 antibody

Catalog No. ABIN7881735

This Rabbit Polyclonal antibody specifically detects MYH6 in WB, FACS and IHC (p). It exhibits reactivity toward Rat, Human and Mouse.

Quick Overview for MYH6 antibody (ABIN7881735)

Target: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYH6 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-MYH6 Antibody

Purpose: Myosin 6 Antibody / MyHC-alpha / MYH6

Sequence: RTLEDQANEY RVKLEEAQRS LNDFTTQRAK LQ

Purification: Antigen affinity purified

Immunogen: Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein were used as the immunogen for the Myosin 6 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Myosin 6 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Myosin 6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MYH6

Target: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Alternative Name: Myosin 6

Background: Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.

UniProt: P13533