MYH10 antibody

Catalog No. ABIN7881741

This Rabbit Polyclonal antibody specifically detects MYH10 in WB, IF, FACS and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MYH10 antibody (ABIN7881741)

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYH10 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-MYH10 Antibody

Purpose: MYH10 Antibody / non-muscle Myosin IIB

Sequence: QRTGLEDPER YLFVDRAVIY NPATQADWTA KK

Purification: Affinity purified

Immunogen: Amino acids QRTGLEDPERYLFVDRAVIYNPATQADWTAKK from the human protein were used as the immunogen for the MYH10 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MYH10 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the MYH10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MYH10

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Alternative Name: MYH10

Background: This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin, it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: P35580