NFIA antibody

Catalog No. ABIN7881836

The Mouse Monoclonal anti-NFIA antibody (Clone 16H11) (ABIN7881836) specifically detects NFIA in WB, IF, FACS and IHC (p). The antibody is reactive with Human samples.

Quick Overview for NFIA antibody (ABIN7881836)

Target: NFIA (Nuclear Factor I/A (NFIA))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This NFIA antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 16H11

Product Details anti-NFIA Antibody

Purpose: NFIA Antibody

Sequence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Purification: Purified

Immunogen: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the NFIA antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Alternative Name: NFIA

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.

UniProt: Q12857