TPR antibody

Catalog No. ABIN7881865

The Rabbit Polyclonal anti-TPR antibody is suitable to detect TPR in samples from Human, Mouse and Rat. It has been validated for WB, IHC (p), IF and FACS.

Quick Overview for TPR antibody (ABIN7881865)

Target: TPR (Nucleoprotein TPR (TPR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Product Details anti-TPR Antibody

Purpose: TPR Antibody / Translocated promoter region protein

Sequence: AAVLQQVLER TELNKLPKSV QNKLEKFLAD QQ

Purification: Antigen affinity purified

Immunogen: Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TPR antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the TPR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for TPR

Target: TPR (Nucleoprotein TPR (TPR))

Alternative Name: TPR

Background: The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.

UniProt: P12270