PRDM14 antibody

Catalog No. ABIN7882022

The Rabbit Polyclonal anti-PRDM14 antibody (ABIN7882022) specifically detects PRDM14 in WB, IF, FACS and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PRDM14 antibody (ABIN7882022)

Target: PRDM14 (PR Domain Containing 14 (PRDM14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRDM14 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-PRDM14 Antibody

Purpose: PRDM14 Antibody

Sequence: QNLAAYYTPF PSYGHYRNSL ATVEEDFQPF RQLEA

Purification: Antigen affinity purified

Immunogen: Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PRDM14 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PRDM14

Target: PRDM14 (PR Domain Containing 14 (PRDM14))

Alternative Name: PRDM14

Background: This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.

UniProt: Q9GZV8