SARS-CoV-2 NSP13 antibody

Catalog No. ABIN7882198

The Rabbit Polyclonal anti-SARS-CoV-2 NSP13 antibody is suitable to detect SARS-CoV-2 NSP13 in samples from Human. It has been validated for ELISA.

Quick Overview for SARS-CoV-2 NSP13 antibody (ABIN7882198)

Target: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SARS-CoV-2 NSP13 antibody is un-conjugated

Application: ELISA

Product Details anti-SARS-CoV-2 NSP13 Antibody

Purpose: SARS-CoV-2 Helicase Antibody / NSP13

Purification: Affinity purified

Immunogen: Amino acids YDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEE
TFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNggggPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVA
ITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ were used as the immunogen for the SARS-CoV-2 Helicase antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SARS-CoV-2 Helicase antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SARS-CoV-2 Helicase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SARS-CoV-2 NSP13

Target: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Alternative Name: SARS-CoV-2 Helicase

Target Type: Viral Protein

Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

UniProt: P0DTD1