SLC34A2 antibody

Catalog No. ABIN7882316

The Rabbit Polyclonal anti-SLC34A2 antibody (ABIN7882316) specifically detects SLC34A2 in WB, IF and IHC (p). The antibody is reactive with Human, Rat and Mouse samples.

Quick Overview for SLC34A2 antibody (ABIN7882316)

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC34A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SLC34A2 Antibody

Purpose: SLC34A2 Antibody

Sequence: QNWTMKNVTY KENIAKCQHI FVNFHLPDLA

Purification: Antigen affinity purified

Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SLC34A2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SLC34A2

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Alternative Name: SLC34A2

Background: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

UniProt: O95436