ULK1 antibody

Catalog No. ABIN7882638

This Rabbit Polyclonal antibody specifically detects ULK1 in WB, FACS and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ULK1 antibody (ABIN7882638)

Target: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ULK1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ULK1 Antibody

Purpose: ULK1 Antibody

Sequence: EETLMEQEHT EILRGLRFTL LFVQHVLEIA ALK

Purification: Affinity purified

Immunogen: Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ULK1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ULK1

Target: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Alternative Name: ULK1

Background: ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.

UniProt: O75385

Pathways: Regulation of Cell Size, Autophagy