DLG3 antibody (N-Term)

Catalog No. ABIN7884915

This Rabbit Polyclonal antibody specifically detects DLG3 in WB and IHC. It exhibits reactivity toward Mouse.

Quick Overview for DLG3 antibody (N-Term) (ABIN7884915)

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Grade: Carrier-free

Product Details anti-DLG3 Antibody

Binding Specificity: AA 93-124, N-Term

Purpose: A Rabbit Polyclonal Antibody to SAP-102

Predicted Reactivity: Rat,mouse - 26,32 amino acid residues identical

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102

Isotype: IgG

Application Details

Application Notes:

WB: 1:400

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Comment:

Negative Control: (ABIN7235227)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW)

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Preservative: Without preservative

Storage: -20 °C

Storage Comment: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Target Details for DLG3

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Alternative Name: Synapse-associated protein 102

Background:

Synonyms: Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG

Description: SAP-102 (also known as DLG3) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.SAP-102 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Moreover, mutations in the SAP102 gene have been linked with a form of mental retardation3.

Gene ID: 1741

UniProt: Q92796