Adrenomedullin 2 antibody

Catalog No. ABIN8094281

The Rabbit Polyclonal anti-Adrenomedullin 2 antibody is suitable to detect Adrenomedullin 2 in samples from Human, Rat, Mouse, Cow, Horse and Pig. It has been validated for IHC.

Quick Overview for Adrenomedullin 2 antibody (ABIN8094281)

Target: Adrenomedullin 2 (ADM2)

Reactivity: Human, Rat, Mouse, Cow, Horse, Pig

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adrenomedullin 2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-Adrenomedullin 2 Antibody

Purpose: ADM2 Antibody

Sequence: GPRRTQAQLL RVGCVLGTCQ VQNLSHRLWQ LMGPAGRQDS APVDPSSPHS

Predicted Reactivity: Cow: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 83%, Rat: 93%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64721-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for Adrenomedullin 2

Target: Adrenomedullin 2 (ADM2)

Alternative Name: ADM2

Background:

Background Information: This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Gene Name: adrenomedullin 2

Alternative Symbols: AM2, dJ579N16.4

Protein Name: ADM2

Molecular Weight: 16 kDa

Gene ID: 79924

NCBI Accession: NP_079142

UniProt: Q7Z4H4

Pathways: Hormone Activity, Feeding Behaviour