DUOXA2 antibody

Catalog No. ABIN8099231

The Rabbit Polyclonal anti-DUOXA2 antibody is suitable to detect DUOXA2 in samples from Human, Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit and Rat. It has been validated for IHC.

Quick Overview for DUOXA2 antibody (ABIN8099231)

Target: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUOXA2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-DUOXA2 Antibody

Purpose: DUOXA2 Antibody

Sequence: RWFWLVRVLL SLFIGAEIVA VHFSAEWFVG TVNTNTSYKA FSAARVTARV

Predicted Reactivity: Cow: 86%, Dog: 86%, Guinea Pig: 86%, Horse: 86%, Human: 100%, Mouse: 86%, Rabbit: 86%, Rat: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64802-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for DUOXA2

Target: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Alternative Name: DUOXA2

Background:

Background Information: This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5.

Gene Name: dual oxidase maturation factor 2

Alternative Symbols: TDH5, SIMNIPHOM

Protein Name: Dual oxidase maturation factor 2

Molecular Weight: 35 kDa

Gene ID: 405753

NCBI Accession: NP_997464

UniProt: Q1HG44

Pathways: Thyroid Hormone Synthesis