GALP antibody

Catalog No. ABIN8101248

The Rabbit Polyclonal anti-GALP antibody (ABIN8101248) specifically detects GALP in IHC. The antibody is reactive with Human and Pig samples.

Quick Overview for GALP antibody (ABIN8101248)

Target: GALP (Galanin-Like Peptide (GALP))

Reactivity: Human, Pig

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALP antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-GALP Antibody

Purpose: GALP Antibody

Sequence: VLHLPQMGDQ DGKRETALEI LDLWKAIDGL PYSHPPQPSK RNVMETFAKP

Predicted Reactivity: Human: 100%, Pig: 93%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63212-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for GALP

Target: GALP (Galanin-Like Peptide (GALP))

Alternative Name: GALP

Background:

Background Information: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors.

Gene Name: galanin-like peptide

Protein Name: Galanin-like peptide

Molecular Weight: 13 kDa

Gene ID: 85569

NCBI Accession: NP_149097

UniProt: Q9UBC7