LGALS7 antibody

Catalog No. ABIN8101252

This Rabbit Polyclonal antibody specifically detects LGALS7 in IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog, Pig and Cow.

Quick Overview for LGALS7 antibody (ABIN8101252)

Target: LGALS7 (Galectin 7 (LGALS7))

Reactivity: Human, Mouse, Rat, Dog, Pig, Cow

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS7 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-LGALS7 Antibody

Purpose: LGALS7 Antibody

Sequence: SRFHVNLLCG EEQGSDAALH FNPRLDTSEV VFNSKEQGSW GREERGPGVP

Predicted Reactivity: Cow: 93%, Dog: 79%, Human: 100%, Mouse: 93%, Pig: 86%, Rat: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64142-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for LGALS7

Target: LGALS7 (Galectin 7 (LGALS7))

Alternative Name: LGALS7

Background:

Background Information: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.

Gene Name: lectin, galactoside-binding, soluble, 7

Alternative Symbols: GAL7, LGALS7A

Protein Name: Galectin-7

Molecular Weight: 15 kDa

Gene ID: 3963

NCBI Accession: NP_002298

UniProt: P47929