GCSH antibody

Catalog No. ABIN8101739

The Rabbit Polyclonal anti-GCSH antibody is suitable to detect GCSH in samples from Human, Mouse, Rat, Cow, Dog, Horse, Rabbit and Guinea Pig. It has been validated for IHC.

Quick Overview for GCSH antibody (ABIN8101739)

Target: GCSH (Glycine Cleavage System H Protein (GCSH))

Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Guinea Pig

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCSH antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-GCSH Antibody

Purpose: GCSH Antibody

Sequence: IGTVGISNFA QEALGDVVYC SLPEVGTKLN KQDEFGALES VKAASELYSP

Predicted Reactivity: Cow: 93%, Dog: 100%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 86%, Rabbit: 93%, Rat: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64204-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for GCSH

Target: GCSH (Glycine Cleavage System H Protein (GCSH))

Alternative Name: GCSH

Background:

Background Information: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.

Gene Name: glycine cleavage system protein H (aminomethyl carrier)

Alternative Symbols: GCE, NKH

Protein Name: Glycine cleavage system H protein, mitochondrial

Molecular Weight: 19 kDa

Gene ID: 2653

NCBI Accession: NP_004474

UniProt: P23434