GnRH2 antibody

Catalog No. ABIN8101864

This Rabbit Polyclonal antibody specifically detects GnRH2 in IHC. It exhibits reactivity toward Human.

Quick Overview for GnRH2 antibody (ABIN8101864)

Target: GnRH2 (Gonadotropin-Releasing Hormone 2 (GnRH2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GnRH2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-GnRH2 Antibody

Purpose: GNRH2 Antibody

Sequence: SDALAPLDDS MPWEGRTTAQ WSLHRKRHLA RTLLTAAREP RPAPPSSNKV

Predicted Reactivity: Human: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP55770-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for GnRH2

Target: GnRH2 (Gonadotropin-Releasing Hormone 2 (GnRH2))

Alternative Name: GNRH2

Background:

Background Information: The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.

Gene Name: gonadotropin-releasing hormone 2

Alternative Symbols: GnRH-II, LH-RHII

Protein Name: Progonadoliberin-2

Molecular Weight: 13 kDa

Gene ID: 2797

NCBI Accession: NP_847902

UniProt: O43555

Pathways: Hormone Activity