LGR5 antibody (Middle Region)

Catalog No. ABIN8104343

The Rabbit Polyclonal anti-LGR5 antibody is suitable to detect LGR5 in samples from Human, Mouse, Rat, Cow, Horse, Pig and Rabbit. It has been validated for IHC.

Quick Overview for LGR5 antibody (Middle Region) (ABIN8104343)

Target: LGR5 (Leucine-Rich Repeat Containing G Protein-Coupled Receptor 5 (LGR5))

Reactivity: Human, Mouse, Rat, Cow, Horse, Pig, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGR5 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-LGR5 Antibody

Binding Specificity: Middle Region

Purpose: LGR5 Antibody - middle region

Sequence: KKDAGMFQAQ DERDLEDFLL DFEEDLKALH SVQCSPSPGP FKPCEHLLDG

Predicted Reactivity: Cow: 93%, Horse: 92%, Human: 100%, Mouse: 93%, Pig: 77%, Rabbit: 93%, Rat: 93%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP59640-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for LGR5

Target: LGR5 (Leucine-Rich Repeat Containing G Protein-Coupled Receptor 5 (LGR5))

Alternative Name: LGR5

Background:

Gene Name: leucine-rich repeat containing G protein-coupled receptor 5

Alternative Symbols: FEX, HG38, GPR49, GPR67, GRP49

Protein Name: Leucine-rich repeat-containing G-protein coupled receptor 5

Molecular Weight: 100 kDa

Gene ID: 8549

NCBI Accession: NP_003658

UniProt: O75473

Pathways: WNT Signaling