MSRB3 antibody

Catalog No. ABIN8105257

This Rabbit Polyclonal antibody specifically detects MSRB3 in IHC. It exhibits reactivity toward Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Saccharomyces cerevisiae and Zebrafish (Danio rerio).

Quick Overview for MSRB3 antibody (ABIN8105257)

Target: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Saccharomyces cerevisiae, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSRB3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-MSRB3 Antibody

Purpose: MSRB3 Antibody

Sequence: ESAFEGEYTH HKDPGIYKCV VCGTPLFKSE TKFDSGSGWP SFHDVINSEA

Predicted Reactivity: Cow: 100%, Dog: 86%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 79%, Zebrafish: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61892-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for MSRB3

Target: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Alternative Name: MSRB3

Background:

Background Information: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.

Gene Name: methionine sulfoxide reductase B3

Alternative Symbols: DFNB74

Protein Name: Methionine-R-sulfoxide reductase B3

Molecular Weight: 21 kDa

Gene ID: 253827

NCBI Accession: NP_932346

UniProt: Q8IXL7