NOX3 antibody

Catalog No. ABIN8106196

This Rabbit Polyclonal antibody specifically detects NOX3 in IHC. It exhibits reactivity toward Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig and Rabbit.

Quick Overview for NOX3 antibody (ABIN8106196)

Target: NOX3 (NADPH Oxidase 3 (NOX3))

Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOX3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-NOX3 Antibody

Purpose: NOX3 Antibody

Sequence: KQIAYNHPSS SIGVFFCGPK ALSRTLQKMC HLYSSADPRG VHFYYNKESF

Predicted Reactivity: Cow: 100%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 92%, Pig: 100%, Rabbit: 100%, Rat: 92%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47185-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for NOX3

Target: NOX3 (NADPH Oxidase 3 (NOX3))

Alternative Name: NOX3

Background:

Background Information: This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.

Gene Name: NADPH oxidase 3

Alternative Symbols: MOX-2, GP91-3

Protein Name: NADPH oxidase 3

Molecular Weight: 65 kDa

Gene ID: 50508

NCBI Accession: NP_056533

UniProt: Q9HBY0