PCTP antibody

Catalog No. ABIN8107995

The Rabbit Polyclonal anti-PCTP antibody (ABIN8107995) specifically detects PCTP in IHC. The antibody is reactive with Human, Rat, Dog, Cow, Guinea Pig, Rabbit and Horse samples.

Quick Overview for PCTP antibody (ABIN8107995)

Target: PCTP (Phosphatidylcholine Transfer Protein (PCTP))

Reactivity: Human, Rat, Dog, Cow, Guinea Pig, Rabbit, Horse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCTP antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-PCTP Antibody

Purpose: PCTP Antibody

Sequence: VLEDCSPTLL ADIYMDSDYR KQWDQYVKEL YEQECNGETV VYWEVKYPFP

Predicted Reactivity: Cow: 86%, Dog: 93%, Guinea Pig: 86%, Horse: 77%, Human: 100%, Rabbit: 86%, Rat: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64249-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for PCTP

Target: PCTP (Phosphatidylcholine Transfer Protein (PCTP))

Alternative Name: PCTP

Background:

Gene Name: phosphatidylcholine transfer protein

Alternative Symbols: PC-TP, STARD2

Protein Name: Phosphatidylcholine transfer protein

Molecular Weight: 25 kDa

Gene ID: 58488

NCBI Accession: NP_067036

UniProt: Q9UKL6