PLAC8 antibody

Catalog No. ABIN8108297

The Rabbit Polyclonal anti-PLAC8 antibody is suitable to detect PLAC8 in samples from Human and Cow. It has been validated for IHC.

Quick Overview for PLAC8 antibody (ABIN8108297)

Target: PLAC8 (Placenta-Specific 8 (PLAC8))

Reactivity: Human, Cow

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLAC8 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-PLAC8 Antibody

Purpose: PLAC8 Antibody

Sequence: AQAPVVVVTQ PGVGPGPAPQ NSNWQTGMCD CFSDCGVCLC GTFCFPCLGC

Predicted Reactivity: Cow: 93%, Human: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47959-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for PLAC8

Target: PLAC8 (Placenta-Specific 8 (PLAC8))

Alternative Name: PLAC8

Background:

Gene Name: placenta-specific 8

Alternative Symbols: C15, DGIC, onzin, PNAS-144

Protein Name: Placenta-specific gene 8 protein

Molecular Weight: 13 kDa

Gene ID: 51316

NCBI Accession: NP_057703

UniProt: Q9NZF1

Pathways: Brown Fat Cell Differentiation