RXFP2 antibody

Catalog No. ABIN8110271

The Rabbit Polyclonal anti-RXFP2 antibody is suitable to detect RXFP2 in samples from Human, Mouse, Rat, Dog, Horse, Cow, Guinea Pig and Rabbit. It has been validated for IHC.

Quick Overview for RXFP2 antibody (ABIN8110271)

Target: RXFP2 (Relaxin/insulin-Like Family Peptide Receptor 2 (RXFP2))

Reactivity: Human, Mouse, Rat, Dog, Horse, Cow, Guinea Pig, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RXFP2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-RXFP2 Antibody

Purpose: RXFP2 Antibody

Sequence: TEVSVLLLTY LTLEKFLVIV FPFSNIRPGK RQTSVILICI WMAGFLIAVI

Predicted Reactivity: Cow: 92%, Dog: 92%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 85%, Rabbit: 86%, Rat: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63832-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for RXFP2

Target: RXFP2 (Relaxin/insulin-Like Family Peptide Receptor 2 (RXFP2))

Alternative Name: RXFP2

Background:

Background Information: This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Gene Name: relaxin/insulin-like family peptide receptor 2

Alternative Symbols: LGR8, GREAT, GPR106, INSL3R, LGR8.1, RXFPR2

Protein Name: Relaxin receptor 2

Molecular Weight: 86 kDa

Gene ID: 122042

NCBI Accession: NP_570718

UniProt: Q8WXD0

Pathways: cAMP Metabolic Process, Myometrial Relaxation and Contraction