RHCG antibody

Catalog No. ABIN8110461

The Rabbit Polyclonal anti-RHCG antibody (ABIN8110461) specifically detects RHCG in IHC. The antibody is reactive with Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Sheep and Zebrafish (Danio rerio) samples.

Quick Overview for RHCG antibody (ABIN8110461)

Target: RHCG (Rh Family C Glycoprotein (RHCG))

Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Sheep, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHCG antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-RHCG Antibody

Purpose: RHCG Antibody

Sequence: QSKERQNSVY QSDLFAMIGT LFLWMYWPSF NSAISYHGDS QHRAAINTYC

Predicted Reactivity: Cow: 86%, Dog: 79%, Guinea Pig: 86%, Horse: 79%, Human: 100%, Mouse: 79%, Rat: 86%, Sheep: 86%, Zebrafish: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP42465-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for RHCG

Target: RHCG (Rh Family C Glycoprotein (RHCG))

Alternative Name: RHCG

Background:

Gene Name: Rh family, C glycoprotein

Alternative Symbols: RHGK, PDRC2, C15orf6, SLC42A3

Protein Name: Ammonium transporter Rh type C

Molecular Weight: 53 kDa

Gene ID: 51458

NCBI Accession: NP_057405

UniProt: Q9UBD6