STXBP2 antibody

Catalog No. ABIN8113314

The Rabbit Polyclonal anti-STXBP2 antibody (ABIN8113314) specifically detects STXBP2 in IHC. The antibody is reactive with Human, Mouse, Rat, Cow, Dog, Horse, Guinea Pig, Rabbit and Zebrafish (Danio rerio) samples.

Quick Overview for STXBP2 antibody (ABIN8113314)

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Guinea Pig, Rabbit, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STXBP2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-STXBP2 Antibody

Purpose: STXBP2 Antibody

Sequence: CMKHFKGSVE KLCSVEQDLA MGSDAEGEKI KDSMKLIVPV LLDAAVPAYD

Predicted Reactivity: Cow: 100%, Dog: 92%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 92%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64422-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for STXBP2

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Alternative Name: STXBP2

Background:

Background Information: This gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Gene Name: syntaxin binding protein 2

Alternative Symbols: FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

Protein Name: Syntaxin-binding protein 2

Molecular Weight: 66 kDa

Gene ID: 6813

NCBI Accession: NP_008880

UniProt: Q15833

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis