YES1 antibody

Catalog No. ABIN8115600

The Rabbit Polyclonal anti-YES1 antibody (ABIN8115600) specifically detects YES1 in IHC. The antibody is reactive with Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Cow, Guinea Pig, Horse and Rabbit samples.

Quick Overview for YES1 antibody (ABIN8115600)

Target: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Cow, Guinea Pig, Horse, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YES1 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-YES1 Antibody

Purpose: YES1 Antibody

Sequence: EQVERGYRMP CPQGCPESLH ELMNLCWKKD PDERPTFEYI QSFLEDYFTA

Predicted Reactivity: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 93%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63762-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for YES1

Target: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Alternative Name: YES1

Background:

Background Information: This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.

Gene Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1

Alternative Symbols: Yes, c-yes, HsT441, P61-YES

Protein Name: Tyrosine-protein kinase Yes

Molecular Weight: 61 kDa

Gene ID: 7525

NCBI Accession: NP_005424

UniProt: P07947

Pathways: CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Thromboxane A2 Receptor Signaling