Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

FHOD1 antibody (Formin Homology 2 Domain Containing 1) (AA 2-99) Primary Antibody

FHOD1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 3F7 unconjugated
Catalog No. ABIN949234
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    FHOD1
    Binding Specificity
    • 15
    • 10
    • 9
    • 8
    • 2
    • 1
    • 1
    AA 2-99
    Reactivity
    • 44
    • 19
    • 16
    Human
    Host
    • 42
    • 2
    Mouse
    Clonality
    • 44
    Monoclonal
    Conjugate
    • 11
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This FHOD1 antibody is un-conjugated
    Application
    • 27
    • 19
    • 14
    • 14
    • 6
    • 4
    • 2
    • 2
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant FHOD1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: FHOD1 (NP_037373.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY

    Clone
    3F7
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    FHOD1
    Alternative Name
    FHOD1 (FHOD1 Antibody Abstract)
    Synonyms
    FHOS, BC017144, FHOS1, formin homology 2 domain containing 1, FHOD1, Fhod1
    Background
    Full Gene Name: formin homology 2 domain containing 1
    Synonyms: FHOS
    Gene ID
    29109
    NCBI Accession
    NP_037373, NM_013241
You are here:
help Support